PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10015887m
Common NameCARUB_v10015887mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family GRF
Protein Properties Length: 251aa    MW: 28943.5 Da    PI: 8.323
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10015887mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC73.13.2e-2383124142
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrks 42 
                      daepgrCrRtDGKkWRCs+++++++k+CErH+hrg++rs++s
  Carubv10015887m  83 DAEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSSSS 124
                      79*************************************987 PP

2QLQ59.87.6e-21641237
              QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                     +FT +Q+++L++Q+l++KyLaan+PvPp+Ll+ i++
  Carubv10015887m  6 PFTESQWEELENQALVFKYLAANVPVPPHLLFLIKR 41
                     8******************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.7E-14541IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.6E-15639IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.49641IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166723.77583127IPR014977WRC domain
PfamPF088794.4E-1984124IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MATRIPFTES QWEELENQAL VFKYLAANVP VPPHLLFLIK RPFLFSSPSS NSSSPSPSSF  60
FSPTLSPHFG WNVYEMGMGR KIDAEPGRCR RTDGKKWRCS KEAYPDSKYC ERHMHRGKNR  120
SSSSRKTLPL TPPHQFTPNL FLESSLSSSR VSRRRSGYMD DFFSIEPSGS IRSSVMEDDE  180
GINREKQPDR HCFILGTDLG TRERPLMLDE DKLKQRDDEE DEEEQRSKRL YRFLDEWPSS  240
KSSVSTSLFI *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00263DAPTransfer from AT2G06200Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0605861e-136AY060586.1 Arabidopsis thaliana At2g06200/F5K7.4 mRNA, complete cds.
GenBankAY1255721e-136AY125572.1 Arabidopsis thaliana At2g06200/F5K7.4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006299696.10.0hypothetical protein CARUB_v10015887mg
SwissprotQ9ZQ121e-120GRF6_ARATH; Growth-regulating factor 6
TrEMBLR0HS360.0R0HS36_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.3__2919__AT2G06200.11e-119(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM141011821
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G06200.11e-102growth-regulating factor 6